EMP2 Antibody
| Name | EMP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86847 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EMP2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EMP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in human cell line MCF-7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2017_EMP2-Antibody-Western-Blot-NBP1-86847-img0007.jpg)
Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in human cell line MCF-7.
![Immunocytochemistry/Immunofluorescence: EMP2 Antibody [NBP1-86847] - Staining of human cell line U-251 MG shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2018_EMP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86847-img0008.jpg)
Immunocytochemistry/Immunofluorescence: EMP2 Antibody [NBP1-86847] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human lung shows strong membranous positivity in pneumocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2019_EMP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86847-img0009.jpg)
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human lung shows strong membranous positivity in pneumocytes.
![Western Blot: EMP2 Antibody [NBP1-86847] - Analysis of EMP2 in NIH/3T3 transfectant using anti-EMP2 antibody (1:500 dilution). Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2020_EMP2-Antibody-Western-Blot-NBP1-86847-img0005.jpg)
Western Blot: EMP2 Antibody [NBP1-86847] - Analysis of EMP2 in NIH/3T3 transfectant using anti-EMP2 antibody (1:500 dilution). Image from verified customer review.
![Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2021_EMP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86847-img0002.jpg)
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.