c-Myb Antibody
| Name | c-Myb Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80306 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human MYB. Peptide sequence YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD. |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | c-Myb Blocking Peptide |
| Description | Rabbit Polyclonal |
| Gene | MYB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: c-Myb Antibody [NBP1-80306] - c-Myb in MOLT-4 cells transfected with siRNA. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15297_c-Myb-Antibody-Western-Blot-NBP1-80306-img0004.jpg)
Western Blot: c-Myb Antibody [NBP1-80306] - c-Myb in MOLT-4 cells transfected with siRNA. Image from verified customer review.
![Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15298_c-Myb%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80306-img0003.jpg)
Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
![Western Blot: c-Myb Antibody [NBP1-80306] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15299_c-Myb%2520Antibody-Western%2520Blot-NBP1-80306-img0001.jpg)
Western Blot: c-Myb Antibody [NBP1-80306] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml