RAP80 Antibody
| Name | RAP80 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87156 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RAP80 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UIMC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RAP80 Antibody [NBP1-87156] - Analysis in human cell line HDLM-2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/4105_RAP80-Antibody-Western-Blot-NBP1-87156-img0006.jpg)
Western Blot: RAP80 Antibody [NBP1-87156] - Analysis in human cell line HDLM-2.
![Immunocytochemistry/Immunofluorescence: RAP80 Antibody [NBP1-87156] - Staining of human cell line U-2 OS shows localization to nucleus & nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/4106_RAP80-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87156-img0007.jpg)
Immunocytochemistry/Immunofluorescence: RAP80 Antibody [NBP1-87156] - Staining of human cell line U-2 OS shows localization to nucleus & nuclear bodies.
![Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/4107_RAP80-Antibody-Immunohistochemistry-Paraffin-NBP1-87156-img0002.jpg)
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.