SUN1 Antibody
| Name | SUN1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87396 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SUN1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SUN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of human cell line A-431 shows positivity in nuclear membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1193_SUN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87396-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of human cell line A-431 shows positivity in nuclear membrane.
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human placenta shows strong nuclear membrane positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1194_SUN1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-87396-img0010.jpg)
Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human placenta shows strong nuclear membrane positivity in trophoblastic cells.
![Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of A431 cells at 4ug/ml against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI (blue), respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1195_SUN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87396-img0005.jpg)
Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of A431 cells at 4ug/ml against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI (blue), respectively.
![Simple Western: SUN1 Antibody [NBP1-87396] - Simple Western lane view shows a specific band for SUN1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1196_SUN1-Antibody-Simple-Western-NBP1-87396-img0007.jpg)
Simple Western: SUN1 Antibody [NBP1-87396] - Simple Western lane view shows a specific band for SUN1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: SUN1 Antibody [NBP1-87396] - Electropherogram image(s) of corresponding Simple Western lane view. SUN1 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1197_SUN1-Antibody-Simple-Western-NBP1-87396-img0009.jpg)
Simple Western: SUN1 Antibody [NBP1-87396] - Electropherogram image(s) of corresponding Simple Western lane view. SUN1 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).