CRBN Antibody
| Name | CRBN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56305 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CRBN(cereblon) The peptide sequence was selected from the N terminal of CRBN. Peptide sequence DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL. |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CRBN Blocking Peptide |
| Description | Rabbit Polyclonal |
| Gene | CRBN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CRBN Antibody [NBP1-56305] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: COLO205 cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24152_CRBN%2520Antibody-Western%2520Blot-NBP1-56305-img0005.jpg)
Western Blot: CRBN Antibody [NBP1-56305] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: COLO205 cell lysate
![Western Blot: CRBN Antibody [NBP1-56305] - RPMI-8226 Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24153_CRBN-Antibody-Western-Blot-NBP1-56305-img0003.jpg)
Western Blot: CRBN Antibody [NBP1-56305] - RPMI-8226 Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.
![Western Blot: CRBN Antibody [NBP1-56305] - Sample Tissue: Human HCT15 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24154_CRBN-Antibody-Western-Blot-NBP1-56305-img0004.jpg)
Western Blot: CRBN Antibody [NBP1-56305] - Sample Tissue: Human HCT15 Antibody Dilution: 1.0 ug/ml