CRBN Blocking Peptide

Name CRBN Blocking Peptide
Supplier Novus Biologicals
Catalog NBP1-56305PEP
Category Peptide
Prices $169.00
Sizes 100 µg
For Antibody CRBN Antibody
Species Reactivities Human
Nature Synthetic
Gene CRBN
Description Synthetic peptides corresponding to CRBN(cereblon) The peptide sequence was selected from the N terminal of CRBN. Peptide sequence DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL.
Supplier Page Shop