Kynureninase Antibody
| Name | Kynureninase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56545 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to KYNU(kynureninase (L-kynurenine hydrolase)) The peptide sequence was selected from the C terminal of KYNU. Peptide sequence LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KYNU |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Kynureninase Antibody [NBP1-56545] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: HepG2 cell lysate KYNU is supported by BioGPS gene expression data to be expressed in HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25708_Kynureninase%2520Antibody-Western%2520Blot-NBP1-56545-img0006.jpg)
Western Blot: Kynureninase Antibody [NBP1-56545] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: HepG2 cell lysate KYNU is supported by BioGPS gene expression data to be expressed in HepG2.
![Immunohistochemistry-Paraffin: Kynureninase Antibody [NBP1-56545] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25709_Kynureninase-Antibody-Immunohistochemistry-Paraffin-NBP1-56545-img0004.jpg)
Immunohistochemistry-Paraffin: Kynureninase Antibody [NBP1-56545] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
![Western Blot: Kynureninase Antibody [NBP1-56545] - KYNU Antibody [NBP1-56545] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25710_Kynureninase-Antibody-Western-Blot-NBP1-56545-img0005.jpg)
Western Blot: Kynureninase Antibody [NBP1-56545] - KYNU Antibody [NBP1-56545] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml