MTO1 Antibody
| Name | MTO1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54767 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to MTO1(mitochondrial translation optimization 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of MTO1 (NP_001116698). Peptide sequence STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MTO1 |
| Supplier Page | Shop |
Product images
![Western Blot: MTO1 Antibody [NBP1-54767] - Detection of MTO1 in HeLa whole cell lysate enriched for mitochondria via digitonin treatment prior to cell pelleting (Hm lane) and human fibroblast whole cell lysate (Fi lane). Image provided by Maria Holmstrom of Gothenburg University.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/15327_MTO1-Antibody-Western-Blot-NBP1-54767-img0005.jpg)
Western Blot: MTO1 Antibody [NBP1-54767] - Detection of MTO1 in HeLa whole cell lysate enriched for mitochondria via digitonin treatment prior to cell pelleting (Hm lane) and human fibroblast whole cell lysate (Fi lane). Image provided by Maria Holmstrom of Gothenburg University.
![Western Blot: MTO1 Antibody [NBP1-54767] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/15328_MTO1%2520Antibody-Western%2520Blot-NBP1-54767-img0003.jpg)
Western Blot: MTO1 Antibody [NBP1-54767] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.