Pannexin-1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59672
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PANX1(pannexin 1) The peptide sequence was selected from the middle region of PANX1. Peptide sequence LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PANX1
• Conjugate: Unconjugated

Product images

Western Blot: Pannexin-1 Antibody [NBP1-59672] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Paraffin Embedded Tissue: Human neural cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Western Blot: Pannexin-1 Antibody [NBP1-59672] - Tissue: Hela whole cell lysates

Western Blot: Pannexin-1 Antibody [NBP1-59672] - PANX1 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate

Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-59672] - Mouse Retina and Knockout PANX-1 Mouse Tissue.

Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Human Jurkat cell lysate Antibody Dilution: 1.0 ug/ml.

Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Human Intestine