DERA Antibody
| Name | DERA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31784 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYAA |
| Description | Rabbit Polyclonal |
| Gene | DERA |
| Supplier Page | Shop |
Product images
![Western Blot: DERA Antibody [NBP2-31784] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/18235_DERA%2520Antibody-Western%2520Blot-NBP2-31784-img0008.jpg)
Western Blot: DERA Antibody [NBP2-31784] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunohistochemistry: DERA Antibody [NBP2-31784] - breast cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/18236_DERA-Antibody-Immunohistochemistry-NBP2-31784-img0007.jpg)
Immunohistochemistry: DERA Antibody [NBP2-31784] - breast cancer
![Western Blot: DERA Antibody [NBP2-31784] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/18237_DERA-Antibody-Western-Blot-NBP2-31784-img0004.jpg)
Western Blot: DERA Antibody [NBP2-31784] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunohistochemistry: DERA Antibody [NBP2-31784] - Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in a fraction of neuronal cells and neurofibrils were distinctly stained.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/18238_DERA-Antibody-Immunohistochemistry-NBP2-31784-img0001.jpg)
Immunohistochemistry: DERA Antibody [NBP2-31784] - Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in a fraction of neuronal cells and neurofibrils were distinctly stained.
![Immunohistochemistry: DERA Antibody [NBP2-31784] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/18239_DERA-Antibody-Immunohistochemistry-NBP2-31784-img0002.jpg)
Immunohistochemistry: DERA Antibody [NBP2-31784] - liver
![Immunohistochemistry: DERA Antibody [NBP2-31784] - breast cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/18240_DERA-Antibody-Immunohistochemistry-NBP2-31784-img0003.jpg)
Immunohistochemistry: DERA Antibody [NBP2-31784] - breast cancer
![Immunohistochemistry: DERA Antibody [NBP2-31784] - Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in a fraction of neuronal cells and neurofibrils were distinctly stained.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/18241_DERA-Antibody-Immunohistochemistry-NBP2-31784-img0005.jpg)
Immunohistochemistry: DERA Antibody [NBP2-31784] - Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in a fraction of neuronal cells and neurofibrils were distinctly stained.
![Immunohistochemistry: DERA Antibody [NBP2-31784] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/18242_DERA-Antibody-Immunohistochemistry-NBP2-31784-img0006.jpg)
Immunohistochemistry: DERA Antibody [NBP2-31784] - liver