MCM6 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-82642
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Mouse, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGV
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: MCM6 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: MCM6

Product images

Western Blot: MCM6 Antibody [NBP1-82642] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).

Immunocytochemistry/Immunofluorescence: MCM6 Antibody [NBP1-82642] - Staining of human cell line U-2 OS shows positivity in nuclei but not nucleoli.

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-82642] - Staining of human lymph node shows strong nuclear positivity in reaction center cells.

Western Blot: MCM6 Antibody [NBP1-82642] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Product References

A five-gene and corresponding protein signature for stage-I lung adenocarcinoma - A five-gene and corresponding protein signature for stage-I lung adenocarcinoma

Kadara H, Behrens C, Yuan P, Solis L, Liu D, Gu X, Minna JD, Lee JJ, Kim E, Hong WK, Wistuba II, Lotan R. Clin Cancer Res. 2011 Mar 15;17(6):1490-501.

Basal level of FANCD2 monoubiquitination is required for the maintenance of a - Basal level of FANCD2 monoubiquitination is required for the maintenance of a

Panneerselvam J, Pickering A, Han B, Li L, Zheng J, Zhang J, Zhang Y, Fei P. Oncotarget. 2014 Mar 15;5(5):1326-37.