GNL3L Antibody
| Name | GNL3L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32660 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QPAKQNGKKATSKVPSAPHFVHPNDHANREAELKKKWVEEMREKQQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GNL3L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GNL3L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GNL3L Antibody [NBP2-32660] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-245](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15772_GNL3L-Antibody-Western-Blot-NBP2-32660-img0003.jpg)
Western Blot: GNL3L Antibody [NBP2-32660] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-245
![Immunocytochemistry/Immunofluorescence: GNL3L Antibody [NBP2-32660] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15773_GNL3L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32660-img0007.jpg)
Immunocytochemistry/Immunofluorescence: GNL3L Antibody [NBP2-32660] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
![Immunohistochemistry: GNL3L Antibody [NBP2-32660] - Staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15774_GNL3L-Antibody-Immunohistochemistry-NBP2-32660-img0002.jpg)
Immunohistochemistry: GNL3L Antibody [NBP2-32660] - Staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.