SLC28A3 Antibody
| Name | SLC28A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84418 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:INCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC28A3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC28A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC28A3 Antibody [NBP1-84418] - Analysis in control (vector only transfected HEK293T lysate) and SLC28A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10506_SLC28A3-Antibody-Western-Blot-NBP1-84418-img0007.jpg)
Western Blot: SLC28A3 Antibody [NBP1-84418] - Analysis in control (vector only transfected HEK293T lysate) and SLC28A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunocytochemistry/Immunofluorescence: SLC28A3 Antibody [NBP1-84418] - Staining of human pancreas cryosection (100x). Ducts and acinar cells (but not islets) are strongly labeled. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10507_SLC28A3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84418-img0005.jpg)
Immunocytochemistry/Immunofluorescence: SLC28A3 Antibody [NBP1-84418] - Staining of human pancreas cryosection (100x). Ducts and acinar cells (but not islets) are strongly labeled. Image from verified customer review.
![Immunohistochemistry-Paraffin: SLC28A3 Antibody [NBP1-84418] - Staining of human pancreas shows strong cytoplasmic positivity in intercalated duct cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10508_SLC28A3-Antibody-Immunohistochemistry-Paraffin-NBP1-84418-img0002.jpg)
Immunohistochemistry-Paraffin: SLC28A3 Antibody [NBP1-84418] - Staining of human pancreas shows strong cytoplasmic positivity in intercalated duct cells.