Hematopoietic Prostaglandin D Synthase/HPGDS Antibody
| Name | Hematopoietic Prostaglandin D Synthase/HPGDS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54625 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PGDS(prostaglandin D2 synthase, hematopoietic) The peptide sequence was selected from the N terminal of PGDS. Peptide sequence EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HPGDS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: HPGDS Antibody [NBP1-54625] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24755_HPGDS%2520Antibody-Western%2520Blot-NBP1-54625-img0003.jpg)
![Immunohistochemistry-Paraffin: HPGDS Antibody [NBP1-54625] - Human Lung tissue, 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24756_HPGDS%2520Antibody-Immunohistochemistry-Paraffin-NBP1-54625-img0002.jpg)