Coactosin-like Protein 1/CotL1 Antibody
| Name | Coactosin-like Protein 1/CotL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54851 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to COTL1(coactosin-like 1 (Dictyostelium)) The peptide sequence was selected from the N terminal of COTL1. Peptide sequence MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | COTL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851] - Analysis of HeLa cell lysate (30ug) using anti-COTL1 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8902_Coactosin-like-Protein-1-CotL1-Antibody-Western-Blot-NBP1-54851-img0005.jpg)
![Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851] - Human Thymus lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8903_Coactosin-like-Protein-1-CotL1-Antibody-Western-Blot-NBP1-54851-img0004.jpg)