TRNT1 Antibody

Name TRNT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57224
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRNT1 (tRNA nucleotidyl transferase, CCA-adding, 1) The peptide sequence was selected from the N terminal of TRNT1. Peptide sequence PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene TRMU
Conjugate Unconjugated
Supplier Page Shop

Product images