MAT2B Antibody

Name MAT2B Antibody
Supplier Novus Biologicals
Catalog NBP1-56616
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAT2B(methionine adenosyltransferase II, beta) The peptide sequence was selected from the N terminal of MAT2B. Peptide sequence KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAT2B
Conjugate Unconjugated
Supplier Page Shop

Product images