MED15 Antibody
| Name | MED15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89018 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MED15 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MED15 |
| Supplier Page | Shop |
Product images
![Western Blot: MED15 Antibody [NBP1-89018] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells); Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/22757_MED15-Antibody-Western-Blot-NBP1-89018-img0004.jpg)
Western Blot: MED15 Antibody [NBP1-89018] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells); Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).
![Immunocytochemistry/Immunofluorescence: MED15 Antibody [NBP1-89018] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/22758_MED15-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89018-img0003.jpg)
Immunocytochemistry/Immunofluorescence: MED15 Antibody [NBP1-89018] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: MED15 Antibody [NBP1-89018] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/22759_MED15-Antibody-Immunohistochemistry-Paraffin-NBP1-89018-img0001.jpg)
Immunohistochemistry-Paraffin: MED15 Antibody [NBP1-89018] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.
![Western Blot: MED15 Antibody [NBP1-89018] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/22760_MED15%2520Antibody-Western%2520Blot-NBP1-89018-img0005.jpg)
Western Blot: MED15 Antibody [NBP1-89018] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human cell line A-431