NSDHL Antibody
| Name | NSDHL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83306 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LPYAMKPIDYYTETKILQERAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGNGKNLVDFTFVENVVHGHILAAEQLSRDSTLGGKAFHITNDEPIPFWTFLSRI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NSDHL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NSDHL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NSDHL Antibody [NBP1-83306] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17261_NSDHL-Antibody-Western-Blot-NBP1-83306-img0007.jpg)
Western Blot: NSDHL Antibody [NBP1-83306] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: NSDHL Antibody [NBP1-83306] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17262_NSDHL-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83306-img0005.jpg)
Immunocytochemistry/Immunofluorescence: NSDHL Antibody [NBP1-83306] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.
![Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17263_NSDHL-Antibody-Immunohistochemistry-Paraffin-NBP1-83306-img0001.jpg)
Immunohistochemistry-Paraffin: NSDHL Antibody [NBP1-83306] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
![Western Blot: NSDHL Antibody [NBP1-83306] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17264_NSDHL-Antibody-Western-Blot-NBP1-83306-img0004.jpg)
Western Blot: NSDHL Antibody [NBP1-83306] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).