DNA Ligase IV Antibody
| Name | DNA Ligase IV Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NB110-57379 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide derived from a region between residues 275 - 324 of human DNA Ligase IV (NP_002303). Peptide sequence DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | LIG4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DNA Ligase IV Antibody [NB110-57379] - Western blot on Hep G2 cell lysate stained with NB110-57379 at 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1859_DNA-Ligase-IV-Antibody-Western-Blot-NB110-57379-img0002.jpg)
Western Blot: DNA Ligase IV Antibody [NB110-57379] - Western blot on Hep G2 cell lysate stained with NB110-57379 at 1.25ug/ml.
![Immunohistochemistry: DNA Ligase IV Antibody [NB110-57379] - Immunohistochemical staining of human pancreatic tissue using NB110-57379 at a concentration of 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1860_DNA-Ligase-IV-Antibody-Immunohistochemistry-NB110-57379-img0003.jpg)
Immunohistochemistry: DNA Ligase IV Antibody [NB110-57379] - Immunohistochemical staining of human pancreatic tissue using NB110-57379 at a concentration of 5 ug/ml.
![Western Blot: DNA Ligase IV Antibody [NB110-57379] - HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1861_DNA-Ligase-IV-Antibody-Western-Blot-NB110-57379-img0001.jpg)
Western Blot: DNA Ligase IV Antibody [NB110-57379] - HepG2 cell lysate.