WBP11 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54648
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to WBP11(WW domain binding protein 11) The peptide sequence was selected from the N terminal of WBP11. Peptide sequence GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: WBP11
• Conjugate: Unconjugated

Product images

Western Blot: WBP11 Antibody [NBP1-54648] - Titration: 2 ug/ml Positive Control: Human NT-2 cells and Mouse WT brain.

Immunocytochemistry/Immunofluorescence: WBP11 Antibody [NBP1-54648] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes; Primary Antibody Concentration: 1:100

Immunohistochemistry: WBP11 Antibody [NBP1-54648] - Jurkat, Antibody Dilution: 1.0 ug/ml WBP11 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Western Blot: WBP11 Antibody [NBP1-54648] - Titration: 2 ug/ml Positive Control: Mouse brain homogenate

Western Blot: WBP11 Antibody [NBP1-54648] - Hela cell lysate, concentration 0.2-1 ug/ml.