SNRP70 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57487
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SNRP70 (small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen)) The peptide sequence was selected from the N terminal of SNRP70 (NP_003080). Peptide sequence PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYS
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SNRNP70
• Conjugate: Unconjugated

Product images

Western Blot: SNRP70 Antibody [NBP1-57487] - Antibody Titration: 1 ug/ml HEK293.

Immunohistochemistry-Paraffin: SNRP70 Antibody [NBP1-57487] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: SNRP70 Antibody [NBP1-57487] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Western Blot: SNRP70 Antibody [NBP1-57487] - Antibody Titration: 1 ug/ml Human Raji.