MTUS1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-60099
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to MTUS1(mitochondrial tumor suppressor 1) The peptide sequence was selected from the middle region of MTUS1. Peptide sequence KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: MTUS1
• Conjugate: Unconjugated

Product images

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: MTUS1 Antibody [NBP1-60099] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: MTUS1 Antibody [NBP1-60099] - MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.

Western Blot: MTUS1 Antibody [NBP1-60099] - MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.

Western Blot: MTUS1 Antibody [NBP1-60099] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml