PDIA6 Antibody

Name PDIA6 Antibody
Supplier Novus Biologicals
Catalog NBP1-57999
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF IHC
Species Reactivities Human
Antigen Synthetic peptides corresponding to PDIA6(protein disulfide isomerase family A, member 6) The peptide sequence was selected from the N terminal of PDIA6. Peptide sequence KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PDIA6
Conjugate Unconjugated
Supplier Page Shop

Product images