KPNA3 Antibody

Name KPNA3 Antibody
Supplier Novus Biologicals
Catalog NBP1-52976
Prices $139.00, $299.00
Sizes 20 µl, 50 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KPNA3(karyopherin alpha 3 (importin alpha 4)) The peptide sequence was selected from the N terminal of KPNA3. Peptide sequence AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KPNA3
Conjugate Unconjugated
Supplier Page Shop

Product images