CTDSPL Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-53169
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CTDSPL(CTD (carboxy-terminal domain) small phosphatase-like) The peptide sequence was selected from the N terminal of CTDSPL. Peptide sequence CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CTDSPL
• Conjugate: Unconjugated