GRHL3 Antibody
| Name | GRHL3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80356 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human GRHL3. Peptide sequence EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | GRHL3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GRHL3 Antibody [NBP1-80356] - Jurkat cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14548_GRHL3%2520Antibody-Western%2520Blot-NBP1-80356-img0001.jpg)
![Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP1-80356] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14549_GRHL3%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80356-img0002.jpg)