TMEM30A Antibody
| Name | TMEM30A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59474 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMEM30A(transmembrane protein 30A) The peptide sequence was selected from the N terminal of TMEM30A. Peptide sequence FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMEM30A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TMEM30A Antibody [NBP1-59474] - 293T Whole Cell lysates, Antibody Dilution: 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19804_TMEM30A-Antibody-Western-Blot-NBP1-59474-img0005.jpg)
Western Blot: TMEM30A Antibody [NBP1-59474] - 293T Whole Cell lysates, Antibody Dilution: 1 ug/ml.
![Immunohistochemistry-Paraffin: TMEM30A Antibody [NBP1-59474] - Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19805_TMEM30A-Antibody-Immunohistochemistry-Paraffin-NBP1-59474-img0003.jpg)
Immunohistochemistry-Paraffin: TMEM30A Antibody [NBP1-59474] - Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal.
![Western Blot: TMEM30A Antibody [NBP1-59474] - 721_B Cell.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19806_TMEM30A-Antibody-Western-Blot-NBP1-59474-img0002.jpg)
Western Blot: TMEM30A Antibody [NBP1-59474] - 721_B Cell.
![Western Blot: TMEM30A Antibody [NBP1-59474] - HepG2 tissue lysate at a concentration of 0.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19807_TMEM30A-Antibody-Western-Blot-NBP1-59474-img0001.jpg)
Western Blot: TMEM30A Antibody [NBP1-59474] - HepG2 tissue lysate at a concentration of 0.25ug/ml.
![Western Blot: TMEM30A Antibody [NBP1-59474] - Sample Tissue: 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19808_TMEM30A-Antibody-Western-Blot-NBP1-59474-img0004.jpg)
Western Blot: TMEM30A Antibody [NBP1-59474] - Sample Tissue: 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12