SLC25A28 Antibody
| Name | SLC25A28 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59562 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC25A28(solute carrier family 25, member 28) The peptide sequence was selected from the C terminal of SLC25A28. Peptide sequence NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC25A28 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC25A28 Antibody [NBP1-59562] - Titration: 1 ug/ml Positive Control: MCF-7 whole cell lysates.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24944_SLC25A28%2520Antibody-Western%2520Blot-NBP1-59562-img0003.jpg)
![Immunohistochemistry-Paraffin: SLC25A28 Antibody [NBP1-59562] - Human kidney Tissue, antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24945_SLC25A28%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59562-img0002.jpg)