cGAS Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-86761
• Prices: $129.00, $419.00
• Sizes: 25 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB Simple Western ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: cGAS Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: MB21D1
• Conjugate: Unconjugated

Product images

Western Blot: cGAS Antibody [NBP1-86761] - Analysis in human cell line THP-1.

Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in Hoffbauer cells and placental trophoblast.

Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in lymphoid cells in lamina propria.

Immunohistochemistry-Paraffin: cGAS Antibody [NBP1-86761] - Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in macrophages and a subset of leukocytes.

Simple Western: cGAS Antibody [NBP1-86761] - Simple Western lane view shows a specific band for MB21D1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: cGAS Antibody [NBP1-86761] - Electropherogram image(s) of corresponding Simple Western lane view. MB21D1 antibody was used at 1:30 dilution on RT-4 lysate(s).