PGAM5 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-92257
• Prices: $129.00, $419.00
• Sizes: 25 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB Simple Western ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PGAM5 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PGAM5
• Conjugate: Unconjugated

Product images

Western Blot: PGAM5 Antibody [NBP1-92257] - Analysis in human cell line A-549.

Immunocytochemistry/Immunofluorescence: PGAM5 Antibody [NBP1-92257] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Immunohistochemical staining of human tonsil shows moderate to strong granular cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Immunohistochemical staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Immunohistochemical staining of human testis shows moderate to strong granular cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Simple Western: PGAM5 Antibody [NBP1-92257] - Simple Western lane view shows a specific band for PGAM5 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: PGAM5 Antibody [NBP1-92257] - Electropherogram image(s) of corresponding Simple Western lane view. PGAM5 antibody was used at 1:60 dilution on RT-4 lysate(s).