UAF1/WDR48 Antibody
| Name | UAF1/WDR48 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81404 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UAF1/WDR48 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | WDR48 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human cell line A-431 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6329_UAF1-WDR48-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81404-img0009.jpg)
Immunocytochemistry/Immunofluorescence: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human cell line A-431 shows localization to vesicles.
![Simple Western: UAF1/WDR48 Antibody [NBP1-81404] - Simple Western lane view shows a specific band for UAF1/WDR48 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6333_UAF1-WDR48-Antibody-Simple-Western-NBP1-81404-img0006.jpg)
Simple Western: UAF1/WDR48 Antibody [NBP1-81404] - Simple Western lane view shows a specific band for UAF1/WDR48 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: UAF1/WDR48 Antibody [NBP1-81404] - Electropherogram image(s) of corresponding Simple Western lane view. UAF1/WDR48 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6334_UAF1-WDR48-Antibody-Simple-Western-NBP1-81404-img0007.jpg)
Simple Western: UAF1/WDR48 Antibody [NBP1-81404] - Electropherogram image(s) of corresponding Simple Western lane view. UAF1/WDR48 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).