AP-2 beta/TFAP2B Antibody
| Name | AP-2 beta/TFAP2B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89063 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AP-2 beta/TFAP2B Protein |
| Description | Rabbit Polyclonal |
| Gene | TFAP2B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: AP-2 beta/TFAP2B Antibody [NBP1-89063] - Staining of human epididymis shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9920_AP-2%2520beta-TFAP2B%2520Antibody-Immunohistochemistry-Paraffin-NBP1-89063-img0008.jpg)
Immunohistochemistry-Paraffin: AP-2 beta/TFAP2B Antibody [NBP1-89063] - Staining of human epididymis shows strong nuclear positivity in glandular cells.