Neuro D4 Antibody
| Name | Neuro D4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13932 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRR KNRAKGKAYGIGGLRKRQDTASLEDR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Neuro D4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DPF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Neuro D4 Antibody [NBP2-13932] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16905_Neuro-D4-Antibody-Western-Blot-NBP2-13932-img0002.jpg)
Western Blot: Neuro D4 Antibody [NBP2-13932] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: Neuro D4 Antibody [NBP2-13932] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16906_Neuro-D4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13932-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Neuro D4 Antibody [NBP2-13932] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human cerebral cortex shows distinct nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16907_Neuro-D4-Antibody-Immunohistochemistry-Paraffin-NBP2-13932-img0001.jpg)
Immunohistochemistry-Paraffin: Neuro D4 Antibody [NBP2-13932] - Staining of human cerebral cortex shows distinct nuclear positivity in neuronal cells.