Exportin-5 Antibody
| Name | Exportin-5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89605 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGEQFRKEVH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Exportin-5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | XPO5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Exportin-5 Antibody [NBP1-89605] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29040_Exportin-5-Antibody-Western-Blot-NBP1-89605-img0006.jpg)
Western Blot: Exportin-5 Antibody [NBP1-89605] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: Exportin-5 Antibody [NBP1-89605] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29041_Exportin-5%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89605-img0007.jpg)
Immunocytochemistry/Immunofluorescence: Exportin-5 Antibody [NBP1-89605] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: Exportin-5 Antibody [NBP1-89605] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in germ cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29042_Exportin-5-Antibody-Immunohistochemistry-Paraffin-NBP1-89605-img0001.jpg)
Immunohistochemistry-Paraffin: Exportin-5 Antibody [NBP1-89605] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in germ cells.
![Western Blot: Exportin-5 Antibody [NBP1-89605] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29043_Exportin-5-Antibody-Western-Blot-NBP1-89605-img0005.jpg)
Western Blot: Exportin-5 Antibody [NBP1-89605] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).