SNX17 Antibody
| Name | SNX17 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92417 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SNX17 Protein |
| Description | Rabbit Polyclonal |
| Gene | SNX17 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SNX17 Antibody [NBP1-92417] - Staining of human cell line A-431 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22268_SNX17-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92417-img0006.jpg)
Immunocytochemistry/Immunofluorescence: SNX17 Antibody [NBP1-92417] - Staining of human cell line A-431 shows localization to vesicles.
![Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human placenta shows moderate cytoplasmic positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22269_SNX17-Antibody-Immunohistochemistry-Paraffin-NBP1-92417-img0009.jpg)
Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human placenta shows moderate cytoplasmic positivity.
![Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22270_SNX17-Antibody-Immunohistochemistry-Paraffin-NBP1-92417-img0007.jpg)
Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
![Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22271_SNX17-Antibody-Immunohistochemistry-Paraffin-NBP1-92417-img0008.jpg)
Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
![Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22272_SNX17%2520Antibody-Immunohistochemistry-Paraffin-NBP1-92417-img0010.jpg)
Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.