WDR68 Antibody

Name WDR68 Antibody
Supplier Novus Biologicals
Catalog NBP1-92589
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:PCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNC
Purity/Format Immunogen affinity purified
Blocking Peptide WDR68 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene DCAF7
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.