SKAP Antibody
| Name | SKAP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-94007 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SKAP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KNSTRN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SKAP Antibody [NBP1-94007] - Analysis in human cell line A-431.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8092_SKAP-Antibody-Western-Blot-NBP1-94007-img0008.jpg)
Western Blot: SKAP Antibody [NBP1-94007] - Analysis in human cell line A-431.
![Immunocytochemistry/Immunofluorescence: SKAP Antibody [NBP1-94007] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8093_SKAP%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-94007-img0009.jpg)
Immunocytochemistry/Immunofluorescence: SKAP Antibody [NBP1-94007] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
![Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8094_SKAP-Antibody-Immunohistochemistry-Paraffin-NBP1-94007-img0002.jpg)
Immunohistochemistry-Paraffin: SKAP Antibody [NBP1-94007] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.
![Simple Western: SKAP Antibody [NBP1-94007] - Simple Western lane view shows a specific band for SKAP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8095_SKAP-Antibody-Simple-Western-NBP1-94007-img0006.jpg)
Simple Western: SKAP Antibody [NBP1-94007] - Simple Western lane view shows a specific band for SKAP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: SKAP Antibody [NBP1-94007] - Electropherogram image(s) of corresponding Simple Western lane view. SKAP antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8096_SKAP-Antibody-Simple-Western-NBP1-94007-img0007.jpg)
Simple Western: SKAP Antibody [NBP1-94007] - Electropherogram image(s) of corresponding Simple Western lane view. SKAP antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).