Name | PSMB10/MECL1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58937 |
Prices | $369.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PSMB10(proteasome (prosome, macropain) subunit, beta type, 10) The peptide sequence was selected from the middle region of PSMB10. Peptide sequence DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PSMB10 |
Conjugate | Unconjugated |
Supplier Page | Shop |