PSMB10/MECL1 Antibody

Name PSMB10/MECL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58937
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PSMB10(proteasome (prosome, macropain) subunit, beta type, 10) The peptide sequence was selected from the middle region of PSMB10. Peptide sequence DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PSMB10
Conjugate Unconjugated
Supplier Page Shop

Product images