| Name | HNRPDL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57156 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HNRPDL (heterogeneous nuclear ribonucleoprotein D-like) The peptide sequence was selected from the middle region of HNRPDL. Peptide sequence TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | HNRNPDL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |