Exosome component 4 Antibody
| Name | Exosome component 4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57180 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EXOSC4 (exosome component 4) The peptide sequence was selected from the N terminal of Exosome component 4. Peptide sequence SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | EXOSC4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Exosome component 4 Antibody [NBP1-57180] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14461_Exosome-component-4-Antibody-Western-Blot-NBP1-57180-img0001.jpg)
Western Blot: Exosome component 4 Antibody [NBP1-57180] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
![Immunohistochemistry-Paraffin: Exosome component 4 Antibody [NBP1-57180] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14462_Exosome-component-4-Antibody-Immunohistochemistry-Paraffin-NBP1-57180-img0004.jpg)
Immunohistochemistry-Paraffin: Exosome component 4 Antibody [NBP1-57180] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
![Immunohistochemistry-Paraffin: Exosome component 4 Antibody [NBP1-57180] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14463_Exosome-component-4-Antibody-Immunohistochemistry-Paraffin-NBP1-57180-img0002.jpg)
Immunohistochemistry-Paraffin: Exosome component 4 Antibody [NBP1-57180] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.