FAAP Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56855
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to C22ORF28 The peptide sequence was selected from the N terminal of C22ORF28. Peptide sequence PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: RTCB
• Conjugate: Unconjugated

Product images

Western Blot: FAAP Antibody [NBP1-56855] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate

Immunohistochemistry: FAAP Antibody [NBP1-56855] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: FAAP Antibody [NBP1-56855] - Hela, Antibody Dilution: 1.0 ug/ml RTCB is supported by BioGPS gene expression data to be expressed in HeLa.

Western Blot: FAAP Antibody [NBP1-56855] - Jurkat, Antibody Dilution: 1.0 ug/ml RTCB is supported by BioGPS gene expression data to be expressed in Jurkat.

Western Blot: FAAP Antibody [NBP1-56855] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Western Blot: FAAP Antibody [NBP1-56855] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml