STRAP Antibody
| Name | STRAP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52949 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to STRAP(serine/threonine kinase receptor associated protein) The peptide sequence was selected from the N terminal of STRAP (NP_009109). Peptide sequence HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | STRAP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: STRAP Antibody [NBP1-52949] - Titration: 0.5ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14596_STRAP%2520Antibody-Western%2520Blot-NBP1-52949-img0005.jpg)
Western Blot: STRAP Antibody [NBP1-52949] - Titration: 0.5ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: STRAP Antibody [NBP1-52949] - Human placenta.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14597_STRAP%2520Antibody-Immunohistochemistry-Paraffin-NBP1-52949-img0006.jpg)
Immunohistochemistry-Paraffin: STRAP Antibody [NBP1-52949] - Human placenta.
![Immunohistochemistry-Paraffin: STRAP Antibody [NBP1-52949] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14598_STRAP%2520Antibody-Immunohistochemistry-Paraffin-NBP1-52949-img0003.jpg)
Immunohistochemistry-Paraffin: STRAP Antibody [NBP1-52949] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.