Rab1A Antibody

Name Rab1A Antibody
Supplier Novus Biologicals
Catalog NBP1-55113
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAB1A(RAB1A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB1A. Peptide sequence AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB1A
Conjugate Unconjugated
Supplier Page Shop

Product images