PORCN Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59677
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PORCN(porcupine homolog (Drosophila)) The peptide sequence was selected from the N terminal of PORCN (NP_073736). Peptide sequence ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PORCN
• Conjugate: Unconjugated

Product images

Western Blot: PORCN Antibody [NBP1-59677] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: PORCN Antibody [NBP1-59677] - SampleType: Mouse Uterus - Dilution 1 in 300. - secondary antibody dilution 1 in 1000.

Western Blot: PORCN Antibody [NBP1-59677] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Western Blot: PORCN Antibody [NBP1-59677] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%