Protocadherin-8 Antibody (6A8)

• Supplier: Novus Biologicals
• Catalog: H00005100-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone: 6A8
• Applications: WB ELISA IHC-P Gene Silencing
• Species Reactivities: Human
• Antigen: PCDH8 (NP_002581, 32 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: PCDH8
• Conjugate: Unconjugated

Product images

Western Blot: Protocadherin-8 Antibody (6A8) [H00005100-M01] - PCDH8 monoclonal antibody (M01), clone 6A8 Analysis of PCDH8 expression in COLO 320 HSR.

Immunohistochemistry-Paraffin: Protocadherin-8 Antibody (6A8) [H00005100-M01] - Analysis of monoclonal antibody to PCDH8 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.

Western Blot: Protocadherin-8 Antibody (6A8) [H00005100-M01] - Analysis of PCDH8 over-expressed 293 cell line, cotransfected with PCDH8 Validated Chimera RNAi ( Cat # H00005100-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDH8 monoclonal antibody (M01), clone 6A8 (Cat # H00005100-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: Protocadherin-8 Antibody (6A8) [H00005100-M01] - Analysis of PCDH8 expression in transfected 293T cell line by PCDH8 monoclonal antibody (M01), clone 6A8.Lane 1: PCDH8 transfected lysate(113 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: Protocadherin-8 Antibody (6A8) [H00005100-M01] - Detection limit for recombinant GST tagged PCDH8 is approximately 0.1ng/ml as a capture antibody.