CLNS1A Antibody

Name CLNS1A Antibody
Supplier Novus Biologicals
Catalog NBP2-33958
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: YTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Purity/Format Immunogen affinity purified
Blocking Peptide CLNS1A Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CLNS1A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.