IL-38/IL-1F10 Antibody
| Name | IL-38/IL-1F10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31798 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICTLPNRGLDRTKVPIFLGIQGGSRCLACVETEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IL-38/IL-1F10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IL1F10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: IL-38/IL-1F10 Antibody [NBP2-31798] - IL1F10 Antibody [NBP2-31798] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8215_IL-38-IL-1F10-Antibody-Immunohistochemistry-Paraffin-NBP2-31798-img0007.jpg)
Immunohistochemistry-Paraffin: IL-38/IL-1F10 Antibody [NBP2-31798] - IL1F10 Antibody [NBP2-31798] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.