Importin-9 Antibody
| Name | Importin-9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31588 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LVAPVILPEMYKIFTMAEVYGIRTRSRAVEIFTTCAHMICNMEELEKGAAKVLIFPVVQQFTEAFVQALQIPDGPT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Importin-9 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IPO9 |
| Supplier Page | Shop |
![Immunohistochemistry: Importin-9 Antibody [NBP2-31588] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6202_Importin-9-Antibody-Immunohistochemistry-NBP2-31588-img0001.jpg)
![Immunohistochemistry: Importin-9 Antibody [NBP2-31588] - skin](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/6203_Importin-9-Antibody-Immunohistochemistry-NBP2-31588-img0002.jpg)
![Immunohistochemistry: Importin-9 Antibody [NBP2-31588] - Liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3936_Importin-9-Antibody-Immunohistochemistry-NBP2-31588-img0007.jpg)