ATRX Antibody
| Name | ATRX Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83077 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ATRX Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATRX |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ATRX Antibody [NBP1-83077] - Analysis in human cell line A-549.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/27710_ATRX%2520Antibody-Western%2520Blot-NBP1-83077-img0018.jpg)
Western Blot: ATRX Antibody [NBP1-83077] - Analysis in human cell line A-549.
![Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/27711_ATRX-Antibody-Immunohistochemistry-Paraffin-NBP1-83077-img0017.jpg)
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
![Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons and glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/27712_ATRX-Antibody-Immunohistochemistry-Paraffin-NBP1-83077-img0013.jpg)
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons and glial cells.
![Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human glioma shows moderate to strong nuclear positivity in tumor cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/27713_ATRX-Antibody-Immunohistochemistry-Paraffin-NBP1-83077-img0014.jpg)
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
![Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Staining of human liver shows no positivity in hepatocytes as expected.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/27714_ATRX-Antibody-Immunohistochemistry-Paraffin-NBP1-83077-img0015.jpg)
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Staining of human liver shows no positivity in hepatocytes as expected.
![Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/27715_ATRX-Antibody-Immunohistochemistry-Paraffin-NBP1-83077-img0016.jpg)
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts and Leydig cells.